SCOPe 2.08: Domain d5jhhf_: 5jhh F:

Lineage for d5jhhf_ (5jhh F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
   Uniprot P61586 2-181

8. Domain d5jhhf_: 5jhh F: [333386]
   Other proteins in same PDB: d5jhha1, d5jhha2, d5jhhe1, d5jhhe2
   automated match to d4f38a_
   complexed with gol, ra0

Details for d5jhhf_

PDB Entry: 5jhh, 2.3 Å

PDB Description: crystal structure of the ternary complex between the human rhoa, its inhibitor and the dh/ph domain of human arhgef11

PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d5jhhf_:

Sequence; same for both SEQRES and ATOM records:

>d5jhhf_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Timeline for d5jhhf_:

• d5jhhf_ first appeared in SCOPe 2.06
  
• d5jhhf_ appears in SCOPe 2.07