SCOPe 2.06: Domain d5jhgf_: 5jhg F:

Lineage for d5jhgf_ (5jhg F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186896] (17 PDB entries)

8. Domain d5jhgf_: 5jhg F: [333384]
   Other proteins in same PDB: d5jhga1, d5jhga2, d5jhge1, d5jhge2
   automated match to d4f38a_
   complexed with gol

Details for d5jhgf_

PDB Entry: 5jhg, 2.5 Å

PDB Description: crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11

PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d5jhgf_:

Sequence; same for both SEQRES and ATOM records:

>d5jhgf_ c.37.1.8 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Timeline for d5jhgf_:

• d5jhgf_ is new in SCOPe 2.06-stable
  
• d5jhgf_ appears in SCOPe 2.07
  
• d5jhgf_ appears in the current release, SCOPe 2.08