SCOPe 2.06: Domain d5ifta5: 5ift A:846-1007

Lineage for d5ifta5 (5ift A:846-1007)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries)

8. Domain d5ifta5: 5ift A:846-1007 [333368]
   Other proteins in same PDB: d5ifta1, d5ifta2, d5ifta3, d5ifta6
   automated match to d1tg7a3
   complexed with bma, cl, dms, gal, glc, man, nag, so4

Details for d5ifta5

PDB Entry: 5ift, 2.45 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 3-b-galactopyranosyl glucose

PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ifta5:

Sequence; same for both SEQRES and ATOM records:

>d5ifta5 b.18.1.0 (A:846-1007) automated matches {Aspergillus niger [TaxId: 425011]}
edkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldlpkgwd
vplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwlavtlw
aldsaggkleslelsyttpvltalgevesvdqpkykkrkgay

Timeline for d5ifta5:

• d5ifta5 is new in SCOPe 2.06-stable
  
• d5ifta5 appears in SCOPe 2.07
  
• d5ifta5 appears in the current release, SCOPe 2.08