Lineage for d5vh6a2 (5vh6 A:281-400)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2062975Species Bacillus subtilis [TaxId:224308] [333353] (1 PDB entry)
  8. 2062976Domain d5vh6a2: 5vh6 A:281-400 [333354]
    Other proteins in same PDB: d5vh6a1, d5vh6a3
    automated match to d2bv3a1
    complexed with cl

Details for d5vh6a2

PDB Entry: 5vh6 (more details), 2.61 Å

PDB Description: 2.6 angstrom resolution crystal structure of n-terminal fragment (residues 1-406) of elongation factor g from bacillus subtilis.
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5vh6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vh6a2 b.43.3.0 (A:281-400) automated matches {Bacillus subtilis [TaxId: 224308]}
ptdvaaikgtrpdtneeierhssdeepfsalafkvmtdpyvgkltffrvysgtldsgsyv
knstkgkrervgrilqmhansreeistvyagdiaaavglkdtttgdtlcdekdlvilesm

SCOPe Domain Coordinates for d5vh6a2:

Click to download the PDB-style file with coordinates for d5vh6a2.
(The format of our PDB-style files is described here.)

Timeline for d5vh6a2: