Lineage for d5vh6a1 (5vh6 A:1-280)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2451968Species Bacillus subtilis [TaxId:224308] [256925] (3 PDB entries)
  8. 2451973Domain d5vh6a1: 5vh6 A:1-280 [333352]
    Other proteins in same PDB: d5vh6a2, d5vh6a3
    automated match to d1efga2
    complexed with cl

Details for d5vh6a1

PDB Entry: 5vh6 (more details), 2.61 Å

PDB Description: 2.6 angstrom resolution crystal structure of n-terminal fragment (residues 1-406) of elongation factor g from bacillus subtilis.
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5vh6a1:

Sequence, based on SEQRES records: (download)

>d5vh6a1 c.37.1.0 (A:1-280) automated matches {Bacillus subtilis [TaxId: 224308]}
marefslektrnigimahidagktttterilfytgrihkigethegasqmdwmeqeqerg
ititsaattaqwkgyrvniidtpghvdftveverslrvldgavavldaqsgvepqtetvw
rqattygvprivfvnkmdkigadflysvgtlrdrlqanahaiqlpigaednfegiidlve
nvayfyeddlgtrsdakeipeeykeqaeelrnslieavceldeelmdkylegeeitidel
kagirkgtlnvefypvlvgsafknkgvqlvldavldylpa

Sequence, based on observed residues (ATOM records): (download)

>d5vh6a1 c.37.1.0 (A:1-280) automated matches {Bacillus subtilis [TaxId: 224308]}
marefslektrnigimahidagktttterilfytgriitsaattaqwkgyrvniidtpgh
vdftveverslrvldgavavldaqsgvepqtetvwrqattygvprivfvnkmdkigadfl
ysvgtlrdrlqanahaiqlpigaednfegiidlvenvayfyeddlgtrsdakeipeeyke
qaeelrnslieavceldeelmdkylegeeitidelkagirkgtlnvefypvlvgsafknk
gvqlvldavldylpa

SCOPe Domain Coordinates for d5vh6a1:

Click to download the PDB-style file with coordinates for d5vh6a1.
(The format of our PDB-style files is described here.)

Timeline for d5vh6a1: