Lineage for d1f1zb2 (1f1z B:8-168)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487731Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 487732Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families) (S)
  5. 487905Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein)
  6. 487906Protein TnsA endonuclease, N-terminal domain [53027] (1 species)
    a catalytic component of the tn7 transposition system
  7. 487907Species Escherichia coli [TaxId:562] [53028] (1 PDB entry)
  8. 487909Domain d1f1zb2: 1f1z B:8-168 [33335]
    Other proteins in same PDB: d1f1za1, d1f1zb1

Details for d1f1zb2

PDB Entry: 1f1z (more details), 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

SCOP Domain Sequences for d1f1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1zb2 c.52.1.16 (B:8-168) TnsA endonuclease, N-terminal domain {Escherichia coli}
fsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelavf
lslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeqf
aiqvkpaaalqdertleklelerrywqqkqipwfiftdkei

SCOP Domain Coordinates for d1f1zb2:

Click to download the PDB-style file with coordinates for d1f1zb2.
(The format of our PDB-style files is described here.)

Timeline for d1f1zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1zb1