![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Diaphorobacter sp. [TaxId:1302548] [319967] (1 PDB entry) |
![]() | Domain d5xbpc_: 5xbp C: [333343] Other proteins in same PDB: d5xbpa1, d5xbpa2, d5xbpd1, d5xbpd2, d5xbpg1, d5xbpg2 automated match to d2bmob1 complexed with fe, fes |
PDB Entry: 5xbp (more details), 2.9 Å
SCOPe Domain Sequences for d5xbpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xbpc_ d.17.4.4 (C:) automated matches {Diaphorobacter sp. [TaxId: 1302548]} mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp erilphnllvfl
Timeline for d5xbpc_: