SCOPe 2.08: Domain d5xbpd1: 5xbp D:2-152

Lineage for d5xbpd1 (5xbp D:2-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Diaphorobacter sp. [TaxId:1302548] [319937] (2 PDB entries)

8. Domain d5xbpd1: 5xbp D:2-152 [333332]
   Other proteins in same PDB: d5xbpa2, d5xbpc_, d5xbpd2, d5xbpf_, d5xbpg2, d5xbpi_
   automated match to d1o7na1
   complexed with fe, fes

Details for d5xbpd1

PDB Entry: 5xbp, 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2

PDB Compounds: (D:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5xbpd1:

Sequence; same for both SEQRES and ATOM records:

>d5xbpd1 b.33.1.0 (D:2-152) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
ygdaikkkclglkevpriesfhgfiygcfda

Timeline for d5xbpd1:

• d5xbpd1 first appeared in SCOPe 2.06
  
• d5xbpd1 appears in SCOPe 2.07