Lineage for d5xbpa2 (5xbp A:153-445)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975670Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2975760Protein automated matches [319939] (2 species)
    not a true protein
  7. 2975761Species Diaphorobacter sp. [TaxId:1302548] [319940] (1 PDB entry)
  8. 2975762Domain d5xbpa2: 5xbp A:153-445 [333331]
    Other proteins in same PDB: d5xbpa1, d5xbpc_, d5xbpd1, d5xbpf_, d5xbpg1, d5xbpi_
    automated match to d1eg9a2
    complexed with fe, fes

Details for d5xbpa2

PDB Entry: 5xbp (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (A:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5xbpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xbpa2 d.129.3.3 (A:153-445) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
eapplidylgdaawymeptfkhsgglelvgppgkvvvkanwktfaenfvgdiyhvgwtha
silrvgqsvftplagnamlppegsglqmtskygsgmslmwdyyagnhsadlvpdlmafgg
akqeklakeigdvrariyrshlngtifpnnsfltgsaafkvwnpidenttevwtyafvek
dmpedlkrrladavqrtvgpggywesddndnmetlsqnakkyqssnsdliaslgfgkdvy
gdecypgvvgpsgasetsyrgfyrayqahisssnwaefenasrnwhteltktt

SCOPe Domain Coordinates for d5xbpa2:

Click to download the PDB-style file with coordinates for d5xbpa2.
(The format of our PDB-style files is described here.)

Timeline for d5xbpa2: