Lineage for d5xbpi_ (5xbp I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936748Species Diaphorobacter sp. [TaxId:1302548] [319967] (1 PDB entry)
  8. 2936751Domain d5xbpi_: 5xbp I: [333325]
    Other proteins in same PDB: d5xbpa1, d5xbpa2, d5xbpd1, d5xbpd2, d5xbpg1, d5xbpg2
    automated match to d2bmob1
    complexed with fe, fes

Details for d5xbpi_

PDB Entry: 5xbp (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (I:) 3NT oxygenase beta subunit

SCOPe Domain Sequences for d5xbpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xbpi_ d.17.4.4 (I:) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
mintqedklvsahdaeefhrfyivqddallqevntlltreahlldiqaykawlehcvape
ikyqvisrelrstserryqlndavniynenyqqlkvrvehqmdpqnwpnspkirftrfvt
nvtaakdksapemlhvrsnlilhrarrgnevdvfyatredkwkriegggiqlverfvdyp
erilphnllvfl

SCOPe Domain Coordinates for d5xbpi_:

Click to download the PDB-style file with coordinates for d5xbpi_.
(The format of our PDB-style files is described here.)

Timeline for d5xbpi_: