Lineage for d5szdh1 (5szd H:4-72)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787433Species Aquifex aeolicus [TaxId:224324] [333224] (1 PDB entry)
  8. 2787441Domain d5szdh1: 5szd H:4-72 [333266]
    Other proteins in same PDB: d5szda2, d5szdb2, d5szdc2, d5szdf2, d5szdg2, d5szdh2, d5szdi2, d5szdj2, d5szdk2, d5szdl2
    automated match to d3sb2a_
    complexed with cl, gai, mpd, mrd, peg

Details for d5szdh1

PDB Entry: 5szd (more details), 1.49 Å

PDB Description: crystal structure of aquifex aeolicus hfq at 1.5a
PDB Compounds: (H:) RNA-binding protein Hfq

SCOPe Domain Sequences for d5szdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szdh1 b.38.1.0 (H:4-72) automated matches {Aquifex aeolicus [TaxId: 224324]}
mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt
ivpherlei

SCOPe Domain Coordinates for d5szdh1:

Click to download the PDB-style file with coordinates for d5szdh1.
(The format of our PDB-style files is described here.)

Timeline for d5szdh1: