Class b: All beta proteins [48724] (180 folds) |
Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily) sandwich; 8 strands in 2 sheets |
Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) automatically mapped to Pfam PF13363 |
Family b.149.1.0: automated matches [254310] (1 protein) not a true family |
Protein automated matches [254712] (3 species) not a true protein |
Species Aspergillus niger [TaxId:425011] [333183] (6 PDB entries) |
Domain d5mgda3: 5mgd A:567-663 [333261] Other proteins in same PDB: d5mgda1, d5mgda2, d5mgda4, d5mgda5, d5mgda6 automated match to d1tg7a1 complexed with 1pe, cl, dms, nag |
PDB Entry: 5mgd (more details), 2.15 Å
SCOPe Domain Sequences for d5mgda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgda3 b.149.1.0 (A:567-663) automated matches {Aspergillus niger [TaxId: 425011]} rnsaynywvpqlatdgtspgfstpekvassiivkagylvrtaylkgsglyltadfnatts vevigvpstaknlfingdktshtvdkngiwsatvdyn
Timeline for d5mgda3: