Lineage for d5mgda3 (5mgd A:567-663)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825002Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
    sandwich; 8 strands in 2 sheets
  4. 2825003Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) (S)
    automatically mapped to Pfam PF13363
  5. 2825009Family b.149.1.0: automated matches [254310] (1 protein)
    not a true family
  6. 2825010Protein automated matches [254712] (3 species)
    not a true protein
  7. 2825011Species Aspergillus niger [TaxId:425011] [333183] (6 PDB entries)
  8. 2825013Domain d5mgda3: 5mgd A:567-663 [333261]
    Other proteins in same PDB: d5mgda1, d5mgda2, d5mgda4, d5mgda5, d5mgda6
    automated match to d1tg7a1
    complexed with 1pe, cl, dms, nag

Details for d5mgda3

PDB Entry: 5mgd (more details), 2.15 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 6-galactosyl-lactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5mgda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mgda3 b.149.1.0 (A:567-663) automated matches {Aspergillus niger [TaxId: 425011]}
rnsaynywvpqlatdgtspgfstpekvassiivkagylvrtaylkgsglyltadfnatts
vevigvpstaknlfingdktshtvdkngiwsatvdyn

SCOPe Domain Coordinates for d5mgda3:

Click to download the PDB-style file with coordinates for d5mgda3.
(The format of our PDB-style files is described here.)

Timeline for d5mgda3: