Lineage for d2ncna1 (2ncn A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933381Domain d2ncna1: 2ncn A:1-126 [333244]
    Other proteins in same PDB: d2ncna2
    automated match to d2zjdc_

Details for d2ncna1

PDB Entry: 2ncn (more details)

PDB Description: solution structure of the autophagy-related protein lc3c
PDB Compounds: (A:) Autophagy-Related Protein LC3C

SCOPe Domain Sequences for d2ncna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ncna1 d.15.1.0 (A:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpppqkipsvrpfkqrkslairqeevagirakfpnkipvvverypretflppldktkflv
pqeltmtqflsiirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtya
sqetfg

SCOPe Domain Coordinates for d2ncna1:

Click to download the PDB-style file with coordinates for d2ncna1.
(The format of our PDB-style files is described here.)

Timeline for d2ncna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ncna2