Lineage for d2fokb4 (2fok B:387-579)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 700832Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families) (S)
  5. 700985Family c.52.1.12: Restriction endonuclease FokI, C-terminal (catalytic) domain [53014] (1 protein)
  6. 700986Protein Restriction endonuclease FokI, C-terminal (catalytic) domain [53015] (1 species)
  7. 700987Species Flavobacterium okeanokoites [TaxId:244] [53016] (2 PDB entries)
  8. 700989Domain d2fokb4: 2fok B:387-579 [33324]
    Other proteins in same PDB: d2foka1, d2foka2, d2foka3, d2fokb1, d2fokb2, d2fokb3

Details for d2fokb4

PDB Entry: 2fok (more details), 2.3 Å

PDB Description: structure of restriction endonuclease foki
PDB Compounds: (B:) foki restriction endonuclease

SCOP Domain Sequences for d2fokb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fokb4 c.52.1.12 (B:387-579) Restriction endonuclease FokI, C-terminal (catalytic) domain {Flavobacterium okeanokoites [TaxId: 244]}
kseleekkselrhklkyvpheyielieiarnstqdrilemkvmeffmkvygyrgkhlggs
rkpdgaiytvgspidygvivdtkaysggynlpigqademqryveenqtrnkhinpnewwk
vypssvtefkflfvsghfkgnykaqltrlnhitncngavlsveelliggemikagtltle
evrrkfnngeinf

SCOP Domain Coordinates for d2fokb4:

Click to download the PDB-style file with coordinates for d2fokb4.
(The format of our PDB-style files is described here.)

Timeline for d2fokb4: