Lineage for d5nhla_ (5nhl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2981977Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries)
  8. 2982030Domain d5nhla_: 5nhl A: [333234]
    automated match to d1erka_
    complexed with 8xb, so4

Details for d5nhla_

PDB Entry: 5nhl (more details), 2.07 Å

PDB Description: human erk2 with an erk1/2 inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d5nhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhla_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfq

SCOPe Domain Coordinates for d5nhla_:

Click to download the PDB-style file with coordinates for d5nhla_.
(The format of our PDB-style files is described here.)

Timeline for d5nhla_: