SCOPe 2.08: Domain d5j87b_: 5j87 B:

Lineage for d5j87b_ (5j87 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5j87b_: 5j87 B: [333230]
   automated match to d4z3va_
   complexed with n42

Details for d5j87b_

PDB Entry: 5j87, 1.59 Å

PDB Description: discovery of n-(3-(5-((3-acrylamido-4-(morpholine-4-carbonyl)phenyl) amino)-1-methyl-6-oxo-1,6-dihydropyridin-3-yl)-2-methylphenyl)-4- (tert-butyl)benzamide (chmfl-btk-01) as a highly selective irreversible btk kinase inhibitor

PDB Compounds: (B:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5j87b_:

Sequence; same for both SEQRES and ATOM records:

>d5j87b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefie
eakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckd
vceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrws
ppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlase
kvytimyscwhekaderptfkillsnildvmdee

Timeline for d5j87b_:

• d5j87b_ first appeared in SCOPe 2.06
  
• d5j87b_ appears in SCOPe 2.07