![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [333224] (1 PDB entry) |
![]() | Domain d5szdl1: 5szd L:4-72 [333225] Other proteins in same PDB: d5szda2, d5szdb2, d5szdc2, d5szdf2, d5szdg2, d5szdh2, d5szdi2, d5szdj2, d5szdk2, d5szdl2 automated match to d3sb2a_ complexed with cl, gai, mpd, mrd, peg |
PDB Entry: 5szd (more details), 1.49 Å
SCOPe Domain Sequences for d5szdl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5szdl1 b.38.1.0 (L:4-72) automated matches {Aquifex aeolicus [TaxId: 224324]} mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt ivpherlei
Timeline for d5szdl1: