SCOPe 2.07: Domain d5mqea_: 5mqe A:

Lineage for d5mqea_ (5mqe A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (37 PDB entries)

8. Domain d5mqea_: 5mqe A: [333221]
   automated match to d4nyva_
   complexed with pku

Details for d5mqea_

PDB Entry: 5mqe, 1.65 Å

PDB Description: crystal structure of crebbp bromodomain complexed with cbp006

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5mqea_:

Sequence; same for both SEQRES and ATOM records:

>d5mqea_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d5mqea_:

• d5mqea_ first appeared in SCOPe 2.06
  
• d5mqea_ appears in the current release, SCOPe 2.08