Lineage for d5mgca3 (5mgc A:567-663)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825002Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
    sandwich; 8 strands in 2 sheets
  4. 2825003Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) (S)
    automatically mapped to Pfam PF13363
  5. 2825009Family b.149.1.0: automated matches [254310] (1 protein)
    not a true family
  6. 2825010Protein automated matches [254712] (3 species)
    not a true protein
  7. 2825011Species Aspergillus niger [TaxId:425011] [333183] (6 PDB entries)
  8. 2825015Domain d5mgca3: 5mgc A:567-663 [333212]
    Other proteins in same PDB: d5mgca1, d5mgca2, d5mgca4, d5mgca5, d5mgca6
    automated match to d1tg7a1
    complexed with nag

Details for d5mgca3

PDB Entry: 5mgc (more details), 2.3 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 4-galactosyl-lactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5mgca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mgca3 b.149.1.0 (A:567-663) automated matches {Aspergillus niger [TaxId: 425011]}
rnsaynywvpqlatdgtspgfstpekvassiivkagylvrtaylkgsglyltadfnatts
vevigvpstaknlfingdktshtvdkngiwsatvdyn

SCOPe Domain Coordinates for d5mgca3:

Click to download the PDB-style file with coordinates for d5mgca3.
(The format of our PDB-style files is described here.)

Timeline for d5mgca3: