Class b: All beta proteins [48724] (180 folds) |
Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily) sandwich; 8 strands in 2 sheets |
Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) automatically mapped to Pfam PF13363 |
Family b.149.1.0: automated matches [254310] (1 protein) not a true family |
Protein automated matches [254712] (3 species) not a true protein |
Species Aspergillus niger [TaxId:425011] [333183] (6 PDB entries) |
Domain d5mgca3: 5mgc A:567-663 [333212] Other proteins in same PDB: d5mgca1, d5mgca2, d5mgca4, d5mgca5, d5mgca6 automated match to d1tg7a1 complexed with nag |
PDB Entry: 5mgc (more details), 2.3 Å
SCOPe Domain Sequences for d5mgca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgca3 b.149.1.0 (A:567-663) automated matches {Aspergillus niger [TaxId: 425011]} rnsaynywvpqlatdgtspgfstpekvassiivkagylvrtaylkgsglyltadfnatts vevigvpstaknlfingdktshtvdkngiwsatvdyn
Timeline for d5mgca3: