Lineage for d5ifpa2 (5ifp A:394-566)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077462Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2077463Protein automated matches [226835] (34 species)
    not a true protein
  7. 2077464Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries)
  8. 2077465Domain d5ifpa2: 5ifp A:394-566 [333190]
    Other proteins in same PDB: d5ifpa1, d5ifpa3, d5ifpa4, d5ifpa5, d5ifpa6
    automated match to d1tg7a4
    complexed with bma, btb, cl, gol, man, nag, so4

Details for d5ifpa2

PDB Entry: 5ifp (more details), 1.71 Å

PDB Description: structure of beta-galactosidase from aspergillus niger
PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d5ifpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifpa2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]}
gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags
vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh
elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld

SCOPe Domain Coordinates for d5ifpa2:

Click to download the PDB-style file with coordinates for d5ifpa2.
(The format of our PDB-style files is described here.)

Timeline for d5ifpa2: