Lineage for d5xa2b_ (5xa2 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.0: automated matches [191338] (1 protein)
not a true familyProtein automated matches [190215] (38 species)
not a true protein
Species Planctopirus limnophila [TaxId:521674] [333102] (1 PDB entry) 
Domain d5xa2b_: 5xa2 B: [333133]
automated match to d4lmab_
Details for d5xa2b_
PDB Entry: 5xa2 (more details), 2.03 Å
PDB Description: crystal structure of o-acetylserine sulfhydrylase from planctomyces limnophila
PDB Compounds: (B:) Cysteine synthaseSCOPe Domain Sequences for d5xa2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xa2b_ c.79.1.0 (B:) automated matches {Planctopirus limnophila [TaxId: 521674]}
mpifkdnsesigrtplvqinrltaglssrvlakiegrnpaysvkcrigaamiwdaeqsgk
lkpgmhvveptsgntgialafvcaargykltltmpetmsierrmmlksfgadlvltpgad
gmkgaiskaeelaaqpgwfipqqfknpanpaihvkttgpeiwndtegqvdvfvagvgtgg
titgvarflkhekkhpvhvvavepaaspvlaggpagrhkiqgigagfvpdtfdrsvvdei
lsvtddeaietarklameegiscgiscgaamagalkvaarpefagktivtvlpdageryl
stalfenlr
SCOPe Domain Coordinates for d5xa2b_:
Click to download the PDB-style file with coordinates for d5xa2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5xa2b_:
- d5xa2b_ first appeared in SCOPe 2.06
- d5xa2b_ appears in SCOPe 2.07
View in 3D
