Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Burkholderia vietnamiensis [TaxId:60552] [333043] (1 PDB entry) |
Domain d5vbff_: 5vbf F: [333099] automated match to d1t90a_ complexed with fmt, gol, mes, unx |
PDB Entry: 5vbf (more details), 2.35 Å
SCOPe Domain Sequences for d5vbff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vbff_ c.82.1.0 (F:) automated matches {Burkholderia vietnamiensis [TaxId: 60552]} dyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwrh esplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrrt ygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpeesp saivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaalaa slmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrfv cayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpgh yfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarna hrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
Timeline for d5vbff_: