SCOPe 2.06: Domain d5veva1: 5vev A:1-101

Lineage for d5veva1 (5vev A:1-101)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (35 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:521006] [333083] (1 PDB entry)

8. Domain d5veva1: 5vev A:1-101 [333084]
   Other proteins in same PDB: d5veva2, d5veva3, d5veva4, d5vevb2, d5vevb3, d5vevb4
   automated match to d1gsoa2
   complexed with act, edo, na, so4

Details for d5veva1

PDB Entry: 5vev, 1.9 Å

PDB Description: crystal structure of phosphoribosylamine-glycine ligase from neisseria gonorrhoeae

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d5veva1:

Sequence; same for both SEQRES and ATOM records:

>d5veva1 c.30.1.0 (A:1-101) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
mkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayqdliefcrk
enivftvvgpeaplaagivddfraaglkifgptqyaaqles

Timeline for d5veva1:

• d5veva1 is new in SCOPe 2.06-stable
  
• d5veva1 appears in SCOPe 2.07
  
• d5veva1 appears in the current release, SCOPe 2.08