Lineage for d5vbfe_ (5vbf E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909202Species Burkholderia vietnamiensis [TaxId:60552] [333043] (1 PDB entry)
  8. 2909207Domain d5vbfe_: 5vbf E: [333057]
    automated match to d1t90a_
    complexed with fmt, gol, mes, unx

Details for d5vbfe_

PDB Entry: 5vbf (more details), 2.35 Å

PDB Description: crystal structure of succinate semialdehyde dehydrogenase from burkholderia vietnamiensis
PDB Compounds: (E:) NAD-dependent succinate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5vbfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbfe_ c.82.1.0 (E:) automated matches {Burkholderia vietnamiensis [TaxId: 60552]}
dyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwrh
esplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrrt
ygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpeesp
saivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaalaa
slmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrfv
cayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpgh
yfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarna
hrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn

SCOPe Domain Coordinates for d5vbfe_:

Click to download the PDB-style file with coordinates for d5vbfe_.
(The format of our PDB-style files is described here.)

Timeline for d5vbfe_: