Lineage for d5ukma3 (5ukm A:550-669)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395020Species Cow (Bos taurus) [TaxId:9913] [317245] (4 PDB entries)
  8. 2395024Domain d5ukma3: 5ukm A:550-669 [333047]
    Other proteins in same PDB: d5ukma1, d5ukma2, d5ukmb_, d5ukmg_
    automated match to d3krwa3
    complexed with cmt, mg, t0e

Details for d5ukma3

PDB Entry: 5ukm (more details), 3.03 Å

PDB Description: bovine grk2 in complex with human gbetagamma subunits and ccg258208 (14as)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukma3:

Sequence, based on SEQRES records: (download)

>d5ukma3 b.55.1.0 (A:550-669) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

Sequence, based on observed residues (ATOM records): (download)

>d5ukma3 b.55.1.0 (A:550-669) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmwqrryfylfpnrlewrgegeapqslltmeeiqsveetqike
rkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

SCOPe Domain Coordinates for d5ukma3:

Click to download the PDB-style file with coordinates for d5ukma3.
(The format of our PDB-style files is described here.)

Timeline for d5ukma3: