SCOPe 2.06: Domain d5ukma1: 5ukm A:31-185

Lineage for d5ukma1 (5ukm A:31-185)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [317242] (4 PDB entries)

8. Domain d5ukma1: 5ukm A:31-185 [333045]
   Other proteins in same PDB: d5ukma2, d5ukma3, d5ukmb_, d5ukmg_
   automated match to d3v5wa1
   complexed with cmt, mg, t0e

Details for d5ukma1

PDB Entry: 5ukm, 3.03 Å

PDB Description: bovine grk2 in complex with human gbetagamma subunits and ccg258208 (14as)

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukma1:

Sequence; same for both SEQRES and ATOM records:

>d5ukma1 a.91.1.0 (A:31-185) automated matches {Bos taurus [TaxId: 9913]}
killpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeeik
kyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpyi
eeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d5ukma1:

• d5ukma1 is new in SCOPe 2.06-stable
  
• d5ukma1 appears in SCOPe 2.07
  
• d5ukma1 appears in the current release, SCOPe 2.08