Lineage for d5ukma1 (5ukm A:31-185)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328088Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2328089Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2328150Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2328151Protein automated matches [190464] (3 species)
    not a true protein
  7. 2328152Species Cow (Bos taurus) [TaxId:9913] [317242] (4 PDB entries)
  8. 2328156Domain d5ukma1: 5ukm A:31-185 [333045]
    Other proteins in same PDB: d5ukma2, d5ukma3, d5ukmb_, d5ukmg_
    automated match to d3v5wa1
    complexed with cmt, mg, t0e

Details for d5ukma1

PDB Entry: 5ukm (more details), 3.03 Å

PDB Description: bovine grk2 in complex with human gbetagamma subunits and ccg258208 (14as)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukma1 a.91.1.0 (A:31-185) automated matches {Cow (Bos taurus) [TaxId: 9913]}
killpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeeik
kyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpyi
eeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5ukma1:

Click to download the PDB-style file with coordinates for d5ukma1.
(The format of our PDB-style files is described here.)

Timeline for d5ukma1: