SCOPe 2.08: Domain d5tcyb1: 5tcy B:24-309

Lineage for d5tcyb1 (5tcy B:24-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein automated matches [190559] (3 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:1316921] [332994] (2 PDB entries)

8. Domain d5tcyb1: 5tcy B:24-309 [332997]
   Other proteins in same PDB: d5tcya2, d5tcyb2, d5tcyc2
   automated match to d3zkwa_
   complexed with 5lc, fe

Details for d5tcyb1

PDB Entry: 5tcy, 1.9 Å

PDB Description: a complex of the synthetic siderophore analogue fe(iii)-5-licam with ceue (h227l variant), a periplasmic protein from campylobacter jejuni.

PDB Compounds: (B:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d5tcyb1:

Sequence; same for both SEQRES and ATOM records:

>d5tcyb1 c.92.2.4 (B:24-309) automated matches {Campylobacter jejuni [TaxId: 1316921]}
lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgtlgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknav

Timeline for d5tcyb1:

• d5tcyb1 first appeared in SCOPe 2.06
  
• d5tcyb1 appears in SCOPe 2.07