Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
Protein automated matches [190559] (3 species) not a true protein |
Species Campylobacter jejuni [TaxId:1316921] [332994] (2 PDB entries) |
Domain d5tcyb1: 5tcy B:24-309 [332997] Other proteins in same PDB: d5tcya2, d5tcyb2, d5tcyc2 automated match to d3zkwa_ complexed with 5lc, fe |
PDB Entry: 5tcy (more details), 1.9 Å
SCOPe Domain Sequences for d5tcyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tcyb1 c.92.2.4 (B:24-309) automated matches {Campylobacter jejuni [TaxId: 1316921]} lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq srfgiihdvlginavdenikvgtlgksinsefileknpdyifvvdrnvilgnkeraqgil dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknav
Timeline for d5tcyb1:
View in 3D Domains from other chains: (mouse over for more information) d5tcya1, d5tcya2, d5tcyc1, d5tcyc2 |