Lineage for d5tcya1 (5tcy A:24-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912675Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 2912706Protein automated matches [190559] (3 species)
    not a true protein
  7. 2912712Species Campylobacter jejuni [TaxId:1316921] [332994] (2 PDB entries)
  8. 2912716Domain d5tcya1: 5tcy A:24-310 [332995]
    Other proteins in same PDB: d5tcya2, d5tcyb2, d5tcyc2
    automated match to d3zkwa_
    complexed with 5lc, fe

Details for d5tcya1

PDB Entry: 5tcy (more details), 1.9 Å

PDB Description: a complex of the synthetic siderophore analogue fe(iii)-5-licam with ceue (h227l variant), a periplasmic protein from campylobacter jejuni.
PDB Compounds: (A:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d5tcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tcya1 c.92.2.4 (A:24-310) automated matches {Campylobacter jejuni [TaxId: 1316921]}
lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgtlgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

SCOPe Domain Coordinates for d5tcya1:

Click to download the PDB-style file with coordinates for d5tcya1.
(The format of our PDB-style files is described here.)

Timeline for d5tcya1: