SCOPe 2.07: Domain d5jiia1: 5jii A:237-339

Lineage for d5jiia1 (5jii A:237-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5jiia1: 5jii A:237-339 [332992]
   Other proteins in same PDB: d5jiia2, d5jiib2
   automated match to d1hzhk3
   complexed with bma, fuc, gal, gol, man, nag, po4

Details for d5jiia1

PDB Entry: 5jii, 1.79 Å

PDB Description: crystal structure of human igg1-fc

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5jiia1:

Sequence; same for both SEQRES and ATOM records:

>d5jiia1 b.1.1.2 (A:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5jiia1:

• d5jiia1 first appeared in SCOPe 2.06
  
• d5jiia1 appears in the current release, SCOPe 2.08