Lineage for d5lsla_ (5lsl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)
  8. 2952478Domain d5lsla_: 5lsl A: [332971]
    automated match to d3mdfa_
    protein/RNA complex

Details for d5lsla_

PDB Entry: 5lsl (more details), 1.65 Å

PDB Description: crystal structure of yeast hsh49p in complex with cus1p binding domain.
PDB Compounds: (A:) Protein HSH49

SCOPe Domain Sequences for d5lsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lsla_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv

SCOPe Domain Coordinates for d5lsla_:

Click to download the PDB-style file with coordinates for d5lsla_.
(The format of our PDB-style files is described here.)

Timeline for d5lsla_: