Lineage for d5ll3c_ (5ll3 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504977Species Lactobacillus buchneri [TaxId:1581] [316142] (5 PDB entries)
  8. 2504984Domain d5ll3c_: 5ll3 C: [332943]
    automated match to d4ysva_
    complexed with plp

Details for d5ll3c_

PDB Entry: 5ll3 (more details), 2.15 Å

PDB Description: structure of the isoleucine 2-epimerase from lactobacillus buchneri (plp complex form)
PDB Compounds: (C:) Isoleucine 2-epimerase

SCOPe Domain Sequences for d5ll3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ll3c_ c.67.1.0 (C:) automated matches {Lactobacillus buchneri [TaxId: 1581]}
nyynlvidhahgatlvdvdgnkyidllasasainvghthekvvkaiadqaqklihytpay
fhhvpgmelseklakiapgnspkmvsfgnsgsdandaiikfaraytgrqyivsymgsyhg
stygsqtlsgsslnmtrkigpmlpsvvhvpypdsyrtypgetehdvslryfnefkkpfes
flpadetacvliepiqgdggiikapeeymqlvykfchehgilfaidevnqglgrtgkmwa
iqqfkdiepdlmsvgkslasgmplsavigkkevmqsldapahlfttagnpvcsaaslatl
dvieyeglveksatdgayakqrflemqqrhpmigdvrmwglnggielvkdpktkepdsda
atkviyyafahgvviitlagnilrfqpplvipreqldqalqvlddaftavengevti

SCOPe Domain Coordinates for d5ll3c_:

Click to download the PDB-style file with coordinates for d5ll3c_.
(The format of our PDB-style files is described here.)

Timeline for d5ll3c_: