SCOPe 2.08: Domain d5j4oa2: 5j4o A:118-228

Lineage for d5j4oa2 (5j4o A:118-228)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.0: automated matches [191601] (1 protein)
   not a true family

6. Protein automated matches [191094] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries)

8. Domain d5j4oa2: 5j4o A:118-228 [332933]
   automated match to d1u5pa2
   complexed with edo, pg4

Details for d5j4oa2

PDB Entry: 5j4o, 1.54 Å

PDB Description: structure of human erythrocytic spectrin alpha chain repeats 16-17

PDB Compounds: (A:) Spectrin alpha chain, erythrocytic 1

SCOPe Domain Sequences for d5j4oa2:

Sequence; same for both SEQRES and ATOM records:

>d5j4oa2 a.7.1.0 (A:118-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqffqdlddeeswieeklirvssqdygrdlqgvqnllkkhkrlegelvahepaiqnvldm
aeklkdkaavgqeeiqlrlaqfvehweklkelakarglkleesleylqfmq

Timeline for d5j4oa2:

• d5j4oa2 first appeared in SCOPe 2.06
  
• d5j4oa2 appears in SCOPe 2.07