Lineage for d5ll3b_ (5ll3 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148904Species Lactobacillus buchneri [TaxId:1581] [316142] (4 PDB entries)
  8. 2148910Domain d5ll3b_: 5ll3 B: [332925]
    automated match to d4ysva_
    complexed with plp

Details for d5ll3b_

PDB Entry: 5ll3 (more details), 2.15 Å

PDB Description: structure of the isoleucine 2-epimerase from lactobacillus buchneri (plp complex form)
PDB Compounds: (B:) Isoleucine 2-epimerase

SCOPe Domain Sequences for d5ll3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ll3b_ c.67.1.0 (B:) automated matches {Lactobacillus buchneri [TaxId: 1581]}
nyynlvidhahgatlvdvdgnkyidllasasainvghthekvvkaiadqaqklihytpay
fhhvpgmelseklakiapgnspkmvsfgnsgsdandaiikfaraytgrqyivsymgsyhg
stygsqtlsgsslnmtrkigpmlpsvvhvpypdsyrtypgetehdvslryfnefkkpfes
flpadetacvliepiqgdggiikapeeymqlvykfchehgilfaidevnqglgrtgkmwa
iqqfkdiepdlmsvgkslasgmplsavigkkevmqsldapahlfttagnpvcsaaslatl
dvieyeglveksatdgayakqrflemqqrhpmigdvrmwglnggielvkdpktkepdsda
atkviyyafahgvviitlagnilrfqpplvipreqldqalqvlddaftavengevti

SCOPe Domain Coordinates for d5ll3b_:

Click to download the PDB-style file with coordinates for d5ll3b_.
(The format of our PDB-style files is described here.)

Timeline for d5ll3b_: