Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
Domain d5lg6a2: 5lg6 A:283-544 [332917] Other proteins in same PDB: d5lg6a1, d5lg6a3, d5lg6a4, d5lg6b1, d5lg6b3, d5lg6b4 automated match to d4fkha2 complexed with nag, zn |
PDB Entry: 5lg6 (more details), 2.5 Å
SCOPe Domain Sequences for d5lg6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lg6a2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d5lg6a2:
View in 3D Domains from other chains: (mouse over for more information) d5lg6b1, d5lg6b2, d5lg6b3, d5lg6b4 |