SCOPe 2.06: Domain d5lg6a1: 5lg6 A:59-282

Lineage for d5lg6a1 (5lg6 A:59-282)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (11 PDB entries)

8. Domain d5lg6a1: 5lg6 A:59-282 [332916]
   Other proteins in same PDB: d5lg6a2, d5lg6a3, d5lg6a4, d5lg6b2, d5lg6b3, d5lg6b4
   automated match to d4fkha1
   complexed with nag, zn

Details for d5lg6a1

PDB Entry: 5lg6, 2.5 Å

PDB Description: structure of the deglycosylated porcine aminopeptidase n ectodomain

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5lg6a1:

Sequence, based on SEQRES records:

>d5lg6a1 b.98.1.0 (A:59-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
itldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviii
hskklnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefq
geladdlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnl
talsnmppkgsstplaedpnwsvtefettpvmstyllayivsef

Sequence, based on observed residues (ATOM records):

>d5lg6a1 b.98.1.0 (A:59-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
itldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviii
hskklnytmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

Timeline for d5lg6a1:

• d5lg6a1 is new in SCOPe 2.06-stable
  
• d5lg6a1 appears in SCOPe 2.07
  
• d5lg6a1 appears in the current release, SCOPe 2.08