SCOPe 2.07: Domain d5jihb2: 5jih B:340-443

Lineage for d5jihb2 (5jih B:340-443)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d5jihb2: 5jih B:340-443 [332905]
   Other proteins in same PDB: d5jiha1, d5jihb1
   automated match to d4dz8a2
   complexed with bma, fuc, man, nag

Details for d5jihb2

PDB Entry: 5jih, 1.66 Å

PDB Description: crystal structure of her2 binding igg1-fc (fcab stab19)

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5jihb2:

Sequence; same for both SEQRES and ATOM records:

>d5jihb2 b.1.1.2 (B:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeylsdsvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvprhsetmrrwahgnvfscsvmhealhnhytqkslsl

Timeline for d5jihb2:

• d5jihb2 first appeared in SCOPe 2.06
  
• d5jihb2 appears in the current release, SCOPe 2.08