Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [332878] (7 PDB entries) |
Domain d5g1mb1: 5g1m B:1-332 [332879] Other proteins in same PDB: d5g1ma2, d5g1mb2 automated match to d3gs6a_ complexed with act, cl, peg |
PDB Entry: 5g1m (more details), 1.8 Å
SCOPe Domain Sequences for d5g1mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g1mb1 c.1.8.0 (B:1-332) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaiped arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq rmrgkgyantdyrqqprwlealsalraaqlid
Timeline for d5g1mb1: