SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ldsb4 (5lds B:634-963)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006991Species Pig (Sus scrofa) [TaxId:9823] [311380] (10 PDB entries)
  8. 2289575Domain d5ldsb4: 5lds B:634-963 [332876]
    Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa3, d5ldsb1, d5ldsb2, d5ldsb3, d5ldsc1, d5ldsc2, d5ldsc3, d5ldsd1, d5ldsd2, d5ldsd3
    automated match to d4fkha4
    complexed with act, bma, nag, zn

Details for d5ldsb4

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsb4 a.118.1.0 (B:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq
aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina
istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql
qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla
wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra
leqalektkanikwvkenkevvlnwfiehs

SCOPe Domain Coordinates for d5ldsb4:

Click to download the PDB-style file with coordinates for d5ldsb4.
(The format of our PDB-style files is described here.)

Timeline for d5ldsb4:

  • d5ldsb4 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06