Lineage for d5ldsb1 (5lds B:63-282)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820710Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)
  8. 2820718Domain d5ldsb1: 5lds B:63-282 [332873]
    Other proteins in same PDB: d5ldsa2, d5ldsa3, d5ldsa4, d5ldsb2, d5ldsb3, d5ldsb4, d5ldsc2, d5ldsc3, d5ldsc4, d5ldsd2, d5ldsd3, d5ldsd4
    automated match to d4fkha1
    complexed with act, nag, zn

Details for d5ldsb1

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsb1:

Sequence, based on SEQRES records: (download)

>d5ldsb1 b.98.1.0 (B:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihskk
lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

Sequence, based on observed residues (ATOM records): (download)

>d5ldsb1 b.98.1.0 (B:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihskk
lnythmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladdl
agfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnmp
pkgsstplaedpnwsvtefettpvmstyllayivsef

SCOPe Domain Coordinates for d5ldsb1:

Click to download the PDB-style file with coordinates for d5ldsb1.
(The format of our PDB-style files is described here.)

Timeline for d5ldsb1: