Lineage for d5v0te_ (5v0t E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483347Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2483348Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2483853Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2483854Protein automated matches [190965] (28 species)
    not a true protein
  7. 2483870Species Burkholderia xenovorans [TaxId:266265] [315156] (2 PDB entries)
  8. 2483875Domain d5v0te_: 5v0t E: [332872]
    automated match to d5hxaa_
    complexed with act, edo, fmt, g6p, oxd, tar, udp

Details for d5v0te_

PDB Entry: 5v0t (more details), 1.95 Å

PDB Description: crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp- forming) from burkholderia xenovorans in complex with glucose-6- phosphate
PDB Compounds: (E:) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)

SCOPe Domain Sequences for d5v0te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0te_ c.87.1.0 (E:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
grliivsnrvapiseggpaagglavgvydalketggmwfgwsgdvlssgqpqikveergp
vtfatialmrrdydqyyrgfsnatlwpafhyradllqydrhdfegywrvnawlaqqlvpl
lreddviwvhdyhlipfaqalraagvknrigfflhipfpasqvllavpphrelvealcsf
dllgfqtapdlrafcdyivneangtadpsasgpltihafgrtlraaaypigvypdeiael
akagergkpvrtmkatlhsrklimsvdrldyskglverfraferllehstaqrnkvsflq
iapptradmhayqdirlqlegesgringrfaeldwtpilyihkqyersvlaalfrtahvg
yvtplrdgmnlvakeyvsaqdpenpgvlvlsrfagaaqeldgalivnpvdidgmaealar
aldmplaerqarhrdmmvqlrennvsvwrdnfmrdlq

SCOPe Domain Coordinates for d5v0te_:

Click to download the PDB-style file with coordinates for d5v0te_.
(The format of our PDB-style files is described here.)

Timeline for d5v0te_: