SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jisb_ (5jis B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (31 species)
    not a true protein
  7. 2289246Species Brucella abortus [TaxId:430066] [332547] (2 PDB entries)
  8. 2289570Domain d5jisb_: 5jis B: [332871]
    automated match to d4airb_

Details for d5jisb_

PDB Entry: 5jis (more details), 2.2 Å

PDB Description: the crystal structure of o-acetyl serine sulfhydralase from brucella abortus
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d5jisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jisb_ c.79.1.0 (B:) automated matches {Brucella abortus [TaxId: 430066]}
mfnsvldtigntplirlskaseltgcdiygkaeflnpgqsvkdraalyiirdaekrgllr
pggvivegtagntgigltmvakalgyrtaivipetqsqekkdalrllgaelievpaapyr
npnnyvrlsgrlaeqlaktepngaiwanqfdntvnrqahiettaqeiwrdtsdqidgfva
avgsggtlagtaiglkernhnikialadphgaalhafyttgelkaegdsitegigqgrit
anlegftpdfsyqipdaealdilfalveeeglclggssginiagairlakdlgpghtivt
vlcdygnryqsklfnpaflrgkslpvprwle

SCOPe Domain Coordinates for d5jisb_:

Click to download the PDB-style file with coordinates for d5jisb_.
(The format of our PDB-style files is described here.)

Timeline for d5jisb_:

  • d5jisb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from other chains:
(mouse over for more information)
d5jisa_