Lineage for d5ksva2 (5ksv A:82-180)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (647 PDB entries)
  8. 2289568Domain d5ksva2: 5ksv A:82-180 [332869]
    Other proteins in same PDB: d5ksva1, d5ksvb1, d5ksvb2
    automated match to d4ozfa2

Details for d5ksva2

PDB Entry: 5ksv (more details), 2.2 Å

PDB Description: crystal structure of hla-dq2.5-clip2
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d5ksva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksva2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwep

SCOPe Domain Coordinates for d5ksva2:

Click to download the PDB-style file with coordinates for d5ksva2.
(The format of our PDB-style files is described here.)

Timeline for d5ksva2:

  • d5ksva2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksva1