Lineage for d5uvma1 (5uvm A:2-114)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157192Protein Putative hydrolase [117791] (2 species)
  7. 2289488Species Ruminiclostridium thermocellum [TaxId:637887] [332789] (1 PDB entry)
  8. 2289559Domain d5uvma1: 5uvm A:2-114 [332860]
    Other proteins in same PDB: d5uvma2, d5uvmb2
    automated match to d1xqub_
    complexed with adn, unx, zn

Details for d5uvma1

PDB Entry: 5uvm (more details), 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393
PDB Compounds: (A:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d5uvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uvma1 d.13.1.1 (A:2-114) Putative hydrolase {Ruminiclostridium thermocellum [TaxId: 637887]}
encvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqil
idihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil

SCOPe Domain Coordinates for d5uvma1:

Click to download the PDB-style file with coordinates for d5uvma1.
(The format of our PDB-style files is described here.)

Timeline for d5uvma1:

  • d5uvma1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5uvma2