Lineage for d5kerg_ (5ker G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688757Species Peromyscus maniculatus [TaxId:10042] [196779] (2 PDB entries)
  8. 2688765Domain d5kerg_: 5ker G: [332858]
    automated match to d4h2la_
    complexed with hem

Details for d5kerg_

PDB Entry: 5ker (more details), 2.2 Å

PDB Description: deer mouse recombinant hemoglobin from high altitude species
PDB Compounds: (G:) Alpha-globin

SCOPe Domain Sequences for d5kerg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kerg_ a.1.1.2 (G:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
vhasldkflasvstvltsky

SCOPe Domain Coordinates for d5kerg_:

Click to download the PDB-style file with coordinates for d5kerg_.
(The format of our PDB-style files is described here.)

Timeline for d5kerg_: