SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kerg_ (5ker G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (41 species)
    not a true protein
  7. 1978760Species Peromyscus maniculatus [TaxId:10042] [196779] (2 PDB entries)
  8. 2289557Domain d5kerg_: 5ker G: [332858]
    automated match to d4h2la_
    complexed with hem

Details for d5kerg_

PDB Entry: 5ker (more details), 2.2 Å

PDB Description: deer mouse recombinant hemoglobin from high altitude species
PDB Compounds: (G:) Alpha-globin

SCOPe Domain Sequences for d5kerg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kerg_ a.1.1.2 (G:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
vhasldkflasvstvltsky

SCOPe Domain Coordinates for d5kerg_:

Click to download the PDB-style file with coordinates for d5kerg_.
(The format of our PDB-style files is described here.)

Timeline for d5kerg_:

  • d5kerg_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06