SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v0td_ (5v0t D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (23 species)
    not a true protein
  7. 2271855Species Burkholderia xenovorans [TaxId:266265] [315156] (2 PDB entries)
  8. 2289553Domain d5v0td_: 5v0t D: [332854]
    automated match to d5hxaa_
    complexed with act, edo, fmt, g6p, oxd, tar, udp

Details for d5v0td_

PDB Entry: 5v0t (more details), 1.95 Å

PDB Description: crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp- forming) from burkholderia xenovorans in complex with glucose-6- phosphate
PDB Compounds: (D:) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)

SCOPe Domain Sequences for d5v0td_:

Sequence, based on SEQRES records: (download)

>d5v0td_ c.87.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
grliivsnrvapiseggpaagglavgvydalketggmwfgwsgdvlssgqpqikveergp
vtfatialmrrdydqyyrgfsnatlwpafhyradllqydrhdfegywrvnawlaqqlvpl
lreddviwvhdyhlipfaqalraagvknrigfflhipfpasqvllavpphrelvealcsf
dllgfqtapdlrafcdyivneangtadpsasgpltihafgrtlraaaypigvypdeiael
akagergkpvrtmkatlhsrklimsvdrldyskglverfraferllehstaqrnkvsflq
iapptradmhayqdirlqlegesgringrfaeldwtpilyihkqyersvlaalfrtahvg
yvtplrdgmnlvakeyvsaqdpenpgvlvlsrfagaaqeldgalivnpvdidgmaealar
aldmplaerqarhrdmmvqlrennvsvwrdnfmrdlqg

Sequence, based on observed residues (ATOM records): (download)

>d5v0td_ c.87.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
grliivsnrvapipaagglavgvydalketggmwfgwsgdvlssgqpqikveergpvtfa
tialmrrdydqyyrgfsnatlwpafhyradllqydrhdfegywrvnawlaqqlvpllred
dviwvhdyhlipfaqalraagvknrigfflhipfpasqvllavpphrelvealcsfdllg
fqtapdlrafcdyivneangtadpsgpltihafgrtlraaaypigvypdeiaelakager
gkpvrtmkatlhsrklimsvdrldyskglverfraferllehstaqrnkvsflqiapptr
admhayqdirlqlegesgringrfaeldwtpilyihkqyersvlaalfrtahvgyvtplr
dgmnlvakeyvsaqdpenpgvlvlsrfagaaqeldgalivnpvdidgmaealaraldmpl
aerqarhrdmmvqlrennvsvwrdnfmrdlqg

SCOPe Domain Coordinates for d5v0td_:

Click to download the PDB-style file with coordinates for d5v0td_.
(The format of our PDB-style files is described here.)

Timeline for d5v0td_:

  • d5v0td_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06