Lineage for d5v0td_ (5v0t D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2271855Species Burkholderia xenovorans [TaxId:266265] [315156] (2 PDB entries)
  8. 2289553Domain d5v0td_: 5v0t D: [332854]
    automated match to d5hxaa_
    complexed with act, edo, fmt, g6p, oxd, tar, udp

Details for d5v0td_

PDB Entry: 5v0t (more details), 1.95 Å

PDB Description: crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp- forming) from burkholderia xenovorans in complex with glucose-6- phosphate
PDB Compounds: (D:) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)

SCOPe Domain Sequences for d5v0td_:

Sequence, based on SEQRES records: (download)

>d5v0td_ c.87.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
grliivsnrvapiseggpaagglavgvydalketggmwfgwsgdvlssgqpqikveergp
vtfatialmrrdydqyyrgfsnatlwpafhyradllqydrhdfegywrvnawlaqqlvpl
lreddviwvhdyhlipfaqalraagvknrigfflhipfpasqvllavpphrelvealcsf
dllgfqtapdlrafcdyivneangtadpsasgpltihafgrtlraaaypigvypdeiael
akagergkpvrtmkatlhsrklimsvdrldyskglverfraferllehstaqrnkvsflq
iapptradmhayqdirlqlegesgringrfaeldwtpilyihkqyersvlaalfrtahvg
yvtplrdgmnlvakeyvsaqdpenpgvlvlsrfagaaqeldgalivnpvdidgmaealar
aldmplaerqarhrdmmvqlrennvsvwrdnfmrdlqg

Sequence, based on observed residues (ATOM records): (download)

>d5v0td_ c.87.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
grliivsnrvapipaagglavgvydalketggmwfgwsgdvlssgqpqikveergpvtfa
tialmrrdydqyyrgfsnatlwpafhyradllqydrhdfegywrvnawlaqqlvpllred
dviwvhdyhlipfaqalraagvknrigfflhipfpasqvllavpphrelvealcsfdllg
fqtapdlrafcdyivneangtadpsgpltihafgrtlraaaypigvypdeiaelakager
gkpvrtmkatlhsrklimsvdrldyskglverfraferllehstaqrnkvsflqiapptr
admhayqdirlqlegesgringrfaeldwtpilyihkqyersvlaalfrtahvgyvtplr
dgmnlvakeyvsaqdpenpgvlvlsrfagaaqeldgalivnpvdidgmaealaraldmpl
aerqarhrdmmvqlrennvsvwrdnfmrdlqg

SCOPe Domain Coordinates for d5v0td_:

Click to download the PDB-style file with coordinates for d5v0td_.
(The format of our PDB-style files is described here.)

Timeline for d5v0td_:

  • d5v0td_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06