SCOPe 2.06: Domain d5ukla3: 5ukl A:550-671

Lineage for d5ukla3 (5ukl A:550-671)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d5ukla3: 5ukl A:550-671 [332851]
   Other proteins in same PDB: d5ukla1, d5ukla2, d5uklb_, d5uklg_
   automated match to d3krwa3
   complexed with mg, six

Details for d5ukla3

PDB Entry: 5ukl, 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukla3:

Sequence; same for both SEQRES and ATOM records:

>d5ukla3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
ap

Timeline for d5ukla3:

• d5ukla3 is new in SCOPe 2.06-stable
  
• d5ukla3 appears in SCOPe 2.07
  
• d5ukla3 appears in the current release, SCOPe 2.08