Lineage for d5ukla3 (5ukl A:550-671)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062184Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2289550Domain d5ukla3: 5ukl A:550-671 [332851]
    Other proteins in same PDB: d5ukla1, d5ukla2, d5uklb_, d5uklg_
    automated match to d3krwa3
    complexed with mg, six

Details for d5ukla3

PDB Entry: 5ukl (more details), 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukla3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
ap

SCOPe Domain Coordinates for d5ukla3:

Click to download the PDB-style file with coordinates for d5ukla3.
(The format of our PDB-style files is described here.)

Timeline for d5ukla3:

  • d5ukla3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06