Lineage for d5ukla2 (5ukl A:186-549)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)
  8. 2289549Domain d5ukla2: 5ukl A:186-549 [332850]
    Other proteins in same PDB: d5ukla1, d5ukla3, d5uklb_, d5uklg_
    automated match to d3v5wa2
    complexed with mg, six

Details for d5ukla2

PDB Entry: 5ukl (more details), 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukla2:

Sequence, based on SEQRES records: (download)

>d5ukla2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d5ukla2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
klldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlgh

SCOPe Domain Coordinates for d5ukla2:

Click to download the PDB-style file with coordinates for d5ukla2.
(The format of our PDB-style files is described here.)

Timeline for d5ukla2:

  • d5ukla2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06