SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ukla1 (5ukl A:31-185)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002317Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2002318Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2002379Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2002380Protein automated matches [190464] (3 species)
    not a true protein
  7. 2002384Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2289548Domain d5ukla1: 5ukl A:31-185 [332849]
    Other proteins in same PDB: d5ukla2, d5ukla3, d5uklb_, d5uklg_
    automated match to d3v5wa1
    complexed with mg, six

Details for d5ukla1

PDB Entry: 5ukl (more details), 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukla1 a.91.1.0 (A:31-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
killpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeeik
kyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpyi
eeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5ukla1:

Click to download the PDB-style file with coordinates for d5ukla1.
(The format of our PDB-style files is described here.)

Timeline for d5ukla1:

  • d5ukla1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06